PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G53200.1
Common NameMFH8.14, TRY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 106aa    MW: 13005.6 Da    PI: 9.9931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G53200.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-083372445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G + W++Ia +++ gR ++++  +w 
      AT5G53200.1 33 MTEQEEDLIFRMYRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72
                     7****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.0E-62977IPR001005SANT/Myb domain
CDDcd001679.18E-63271No hitNo description
PfamPF002491.4E-73372IPR001005SANT/Myb domain
SuperFamilySSF466891.88E-73472IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-103472IPR009057Homeodomain-like
PROSITE profilePS500906.3073471IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0007275Biological Processmulticellular organism development
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000263anatomynon-hair root epidermal cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MDNTDRRRRR KQHKIALHDS EEVSSIEWEF INMTEQEEDL IFRMYRLVGD RWDLIAGRVP  60
GRQPEEIERY WIMRNSEGFA DKRRQLHSSS HKHTKPHRPR FSIYPS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.275020.0bud| inflorescence| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306962960.0
Genevisible248246_at1e-143
Expression AtlasAT5G53200-
AtGenExpressAT5G53200-
ATTED-IIAT5G53200-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}.
Function -- GeneRIF ? help Back to Top
  1. The TRY protein has specific properties relevant for cluster formation and trichome density.
    [PMID: 21951724]
  2. Mutations in CPC or TRY delay flowering of cpl3 plants. A mutation in ETC1 did not further delay flowering but reduced plant size.
    [PMID: 23796522]
  3. AtMYC1 is negative regulator of TRY.
    [PMID: 23900543]
  4. Data show that TRANSPARENT TESTA GLABRA 2 (TTG2) is a specific activator of TRYPTICHON protein (TRY) by binding to W-boxes in a minimal promoter fragment of TRY.
    [PMID: 25304203]
  5. TRY, but not the related factor CPC, is responsible for the preferential SCM accumulation.
    [PMID: 25482776]
  6. In an intricate interplay between three partly redundant single R3 MYB proteins, CPC, ETC1, and TRY regulate several developmental, physiological and metabolic processes that are putatively located in different tissues.
    [PMID: 26022254]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G53200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G63650 (A), AT1G79840 (A), AT2G42200 (A), AT2G46410 (R), AT3G27920 (A), AT5G14750 (A), AT5G40330 (A), AT5G41315 (A), AT5G53200 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G79840(R), AT2G02480(R), AT2G37260(R), AT5G53200(R), AT5G65930(R)
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G63650EGL3 interacts with TRY.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G63650
IntActSearch Q8GV05
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G53200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1612861e-180AY161286.1 Arabidopsis thaliana TRIPTYCHON mRNA, complete cds.
GenBankAY5195231e-180AY519523.1 Arabidopsis thaliana MYB transcription factor (At5g53200) mRNA, complete cds.
GenBankBT0246721e-180BT024672.1 Arabidopsis thaliana unknown protein (At5g53200) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200132.26e-74transcription factor TRY
SwissprotQ8GV057e-76TRY_ARATH; Transcription factor TRY
TrEMBLD7MSV51e-72D7MSV5_ARALL; Putative uncharacterized protein
STRINGAT5G53200.12e-73(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Representative plantOGRP4207823
Publications ? help Back to Top
  1. Schnittger A,Folkers U,Schwab B,J
    Generation of a spacing pattern: the role of triptychon in trichome patterning in Arabidopsis.
    Plant Cell, 1999. 11(6): p. 1105-16
    [PMID:10368181]
  2. Luo D,Oppenheimer DG
    Genetic control of trichome branch number in Arabidopsis: the roles of the FURCA loci.
    Development, 1999. 126(24): p. 5547-57
    [PMID:10572032]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Schellmann S, et al.
    TRIPTYCHON and CAPRICE mediate lateral inhibition during trichome and root hair patterning in Arabidopsis.
    EMBO J., 2002. 21(19): p. 5036-46
    [PMID:12356720]
  5. Zhang F,Gonzalez A,Zhao M,Payne CT,Lloyd A
    A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis.
    Development, 2003. 130(20): p. 4859-69
    [PMID:12917293]
  6. Esch JJ, et al.
    A contradictory GLABRA3 allele helps define gene interactions controlling trichome development in Arabidopsis.
    Development, 2003. 130(24): p. 5885-94
    [PMID:14561633]
  7. Serna L
    A network of interacting factors triggering different cell fates.
    Plant Cell, 2004. 16(9): p. 2258-63
    [PMID:15342905]
  8. Montiel G,Gantet P,Jay-Allemand C,Breton C
    Transcription factor networks. Pathways to the knowledge of root development.
    Plant Physiol., 2004. 136(3): p. 3478-85
    [PMID:15542499]
  9. Kirik V, et al.
    Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation.
    Development, 2005. 132(7): p. 1477-85
    [PMID:15728674]
  10. Serna L
    Epidermal cell patterning and differentiation throughout the apical-basal axis of the seedling.
    J. Exp. Bot., 2005. 56(418): p. 1983-9
    [PMID:15967776]
  11. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  12. Kwak SH,Schiefelbein J
    The role of the SCRAMBLED receptor-like kinase in patterning the Arabidopsis root epidermis.
    Dev. Biol., 2007. 302(1): p. 118-31
    [PMID:17027738]
  13. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  14. Morohashi K, et al.
    Participation of the Arabidopsis bHLH factor GL3 in trichome initiation regulatory events.
    Plant Physiol., 2007. 145(3): p. 736-46
    [PMID:17885086]
  15. Wang S, et al.
    Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis.
    BMC Plant Biol., 2008. 8: p. 81
    [PMID:18644155]
  16. Digiuni S, et al.
    A competitive complex formation mechanism underlies trichome patterning on Arabidopsis leaves.
    Mol. Syst. Biol., 2008. 4: p. 217
    [PMID:18766177]
  17. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  18. Ben
    Interlinked nonlinear subnetworks underlie the formation of robust cellular patterns in Arabidopsis epidermis: a dynamic spatial model.
    BMC Syst Biol, 2008. 2: p. 98
    [PMID:19014692]
  19. Li SF, et al.
    The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis.
    Plant Cell, 2009. 21(1): p. 72-89
    [PMID:19136646]
  20. Wester K, et al.
    Functional diversity of R3 single-repeat genes in trichome development.
    Development, 2009. 136(9): p. 1487-96
    [PMID:19336467]
  21. Kang YH, et al.
    The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
    Plant Cell, 2009. 21(4): p. 1080-94
    [PMID:19395683]
  22. Serna L
    CAPRICE positively regulates stomatal formation in the Arabidopsis hypocotyl.
    Plant Signal Behav, 2008. 3(12): p. 1077-82
    [PMID:19513241]
  23. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  24. Plett JM,Mathur J,Regan S
    Ethylene receptor ETR2 controls trichome branching by regulating microtubule assembly in Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(13): p. 3923-33
    [PMID:19648171]
  25. Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
    Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana.
    Protoplasma, 2010. 241(1-4): p. 29-36
    [PMID:20101514]
  26. Xing S, et al.
    Disruption of the 1-deoxy-D-xylulose-5-phosphate reductoisomerase (DXR) gene results in albino, dwarf and defects in trichome initiation and stomata closure in Arabidopsis.
    Cell Res., 2010. 20(6): p. 688-700
    [PMID:20404857]
  27. Yu N, et al.
    Temporal control of trichome distribution by microRNA156-targeted SPL genes in Arabidopsis thaliana.
    Plant Cell, 2010. 22(7): p. 2322-35
    [PMID:20622149]
  28. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  29. Gilding EK,Marks MD
    Analysis of purified glabra3-shapeshifter trichomes reveals a role for NOECK in regulating early trichome morphogenic events.
    Plant J., 2010. 64(2): p. 304-17
    [PMID:21070410]
  30. Niu Y, et al.
    Auxin modulates the enhanced development of root hairs in Arabidopsis thaliana (L.) Heynh. under elevated CO(2).
    Plant Cell Environ., 2011. 34(8): p. 1304-17
    [PMID:21477123]
  31. Guan X, et al.
    Activation of Arabidopsis seed hair development by cotton fiber-related genes.
    PLoS ONE, 2011. 6(7): p. e21301
    [PMID:21779324]
  32. Pesch M,H
    Role of TRIPTYCHON in trichome patterning in Arabidopsis.
    BMC Plant Biol., 2011. 11: p. 130
    [PMID:21951724]
  33. Gan L,Xia K,Chen JG,Wang S
    Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis.
    BMC Plant Biol., 2011. 11: p. 176
    [PMID:22168948]
  34. Bruex A, et al.
    A gene regulatory network for root epidermis cell differentiation in Arabidopsis.
    PLoS Genet., 2012. 8(1): p. e1002446
    [PMID:22253603]
  35. Zhao H, et al.
    A single amino acid substitution in IIIf subfamily of basic helix-loop-helix transcription factor AtMYC1 leads to trichome and root hair patterning defects by abolishing its interaction with partner proteins in Arabidopsis.
    J. Biol. Chem., 2012. 287(17): p. 14109-21
    [PMID:22334670]
  36. Tominaga-Wada R,Nukumizu Y
    Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
    Int J Mol Sci, 2012. 13(3): p. 3478-91
    [PMID:22489163]
  37. Nukumizu Y,Wada T,Tominaga-Wada R
    Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation.
    Plant Signal Behav, 2013. 8(7): p. e24575
    [PMID:23603939]
  38. Wang G,Zhao GH,Jia YH,Du XM
    Identification and characterization of cotton genes involved in fuzz-fiber development.
    J Integr Plant Biol, 2013. 55(7): p. 619-30
    [PMID:23710824]
  39. Tominaga-Wada R,Nukumizu Y,Wada T
    Flowering is delayed by mutations in homologous genes CAPRICE and TRYPTICHON in the early flowering Arabidopsis cpl3 mutant.
    J. Plant Physiol., 2013. 170(16): p. 1466-8
    [PMID:23796522]
  40. Pesch M,Schulthei
    Mutual control of intracellular localisation of the patterning proteins AtMYC1, GL1 and TRY/CPC in Arabidopsis.
    Development, 2013. 140(16): p. 3456-67
    [PMID:23900543]
  41. Pesch M,Dartan B,Birkenbihl R,Somssich IE,H
    Arabidopsis TTG2 regulates TRY expression through enhancement of activator complex-triggered activation.
    Plant Cell, 2014. 26(10): p. 4067-83
    [PMID:25304203]
  42. Kwak SH,Schiefelbein J
    TRIPTYCHON, not CAPRICE, participates in feedback regulation of SCM expression in the Arabidopsis root epidermis.
    Plant Signal Behav, 2014. 9(11): p. e973815
    [PMID:25482776]
  43. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  44. Chen CY,Schmidt W
    The paralogous R3 MYB proteins CAPRICE, TRIPTYCHON and ENHANCER OF TRY AND CPC1 play pleiotropic and partly non-redundant roles in the phosphate starvation response of Arabidopsis roots.
    J. Exp. Bot., 2015. 66(15): p. 4821-34
    [PMID:26022254]
  45. Szymanski DB,Marks MD
    GLABROUS1 overexpression and TRIPTYCHON alter the cell cycle and trichome cell fate in Arabidopsis.
    Plant Cell, 1998. 10(12): p. 2047-62
    [PMID:9836744]